DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and KLK10

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:264 Identity:70/264 - (26%)
Similarity:113/264 - (42%) Gaps:19/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEEL---CGGSLVKPRW 67
            |..|.:.|:....:|:....|: ::.|...|   |.........||:....|   |.|.||...|
Human    20 LLPLLMAQLWAAEAALLPQNDT-RLDPEAYG---SPCARGSQPWQVSLFNGLSFHCAGVLVDQSW 80

  Fly    68 VITAAHCVYNK------NKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLN 126
            |:||||| .||      ..:...:..|...:....:|:....:....|...|:|...|:..|:|.
Human    81 VLTAAHC-GNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLA 144

  Fly   127 SDMI-GANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIH 190
            ..:: |..:..:.|..:........:|:|||...|...|..:.:....:.:.|...|...:.|: 
Human   145 RPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGV- 208

  Fly   191 RITRSMVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFG-YGCASAL-PGIYTSVPEIRDWFQRV 253
             :|.:|:||.....:|.|..|||||||....|.||:|:| |.|.||. |.:||.:.:...|..:|
Human   209 -VTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKV 272

  Fly   254 VEQH 257
            :..:
Human   273 IRSN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 62/227 (27%)
Tryp_SPc 34..253 CDD:238113 63/230 (27%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 63/228 (28%)
Tryp_SPc 49..269 CDD:214473 62/225 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.