DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and PRSS3

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:234 Identity:76/234 - (32%)
Similarity:119/234 - (50%) Gaps:17/234 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNK-----NKNDFKIYGGASNQ 92
            :|:||:........|.|.:.:....|||||:..:||::||||...:     .:::.|:..|....
Human   109 KIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQF 173

  Fly    93 AGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSD-MIGANIETIPLAAQSVPARALVKVSGWG 156
            .....:||       .|.:||.||:.|:..::|:|. :|.|.:.||.|......|.....:||||
Human   174 INAAKIIR-------HPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWG 231

  Fly   157 FLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLY-KKDSCDGDSGGPLVYRG 220
            ...:......:.:..:..|:.::|.|.:::.|  :||.||.|...|. .||||..|||||:|..|
Human   232 NTLSFGADYPDELKCLDAPVLTQAECKASYPG--KITNSMFCVGFLEGGKDSCQRDSGGPVVCNG 294

  Fly   221 QLAGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVEQHS 258
            ||.|:||:|:||| ...||:||.|....||.:..:..:|
Human   295 QLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 73/223 (33%)
Tryp_SPc 34..253 CDD:238113 75/226 (33%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 74/224 (33%)
Tryp_SPc 110..328 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.