DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and PROC

DIOPT Version :10

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_024308771.1 Gene:PROC / 5624 HGNCID:9451 Length:556 Species:Homo sapiens


Alignment Length:102 Identity:20/102 - (19%)
Similarity:35/102 - (34%) Gaps:35/102 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PSHPSHPSPEIQTTTVKKGKKRTKRNDKNHEEESPDHEIHIWTERERRKKMRDMFSKLHALLPQL 99
            |..|.|.|.|.|..        .::.|...|..||.                       .:|.::
Human   122 PLLPQHSSLETQLF--------CEQGDGGTEGHSPS-----------------------GILEKI 155

  Fly   100 PPKADKSTIVDEAVSSIKSLEQ-TLQKLEMQKLEKLQ 135
            ||.::.:.::   |.....||| .|..:.:|:..:|:
Human   156 PPDSEATLVL---VGRADFLEQPVLGFVRLQEAAELE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 20/102 (20%)
PROCXP_024308771.1 GLA 85..148 CDD:214503 8/33 (24%)
EGF_CA 162..193 CDD:238011 7/31 (23%)
FXa_inhibition 235..270 CDD:464251
Tryp_SPc 308..543 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.