DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and PLAT

DIOPT Version :10

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_000921.1 Gene:PLAT / 5327 HGNCID:9051 Length:562 Species:Homo sapiens


Alignment Length:267 Identity:74/267 - (27%)
Similarity:114/267 - (42%) Gaps:50/267 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEE-------LCGGSLVKPRWVITAAHCVYNKN 79
            |:.|     |.||.||..:.|....:...:.....       ||||.|:...|:::||||...:.
Human   304 YSQP-----QFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERF 363

  Fly    80 K---------NDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIE 135
            .         ..:::..|...|.     .....|| :..:|:..|.:.|:|.|:|.||......|
Human   364 PPHHLTVILGRTYRVVPGEEEQK-----FEVEKYI-VHKEFDDDTYDNDIALLQLKSDSSRCAQE 422

  Fly   136 T-------IPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRIT 193
            :       :|.|...:|.....::||:|...|.:...:||:....|.::..:.|.|.......:|
Human   423 SSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQHLLNRTVT 487

  Fly   194 RSMVCA---------ARLYKKDSCDGDSGGPLVY----RGQLAGIVSFGYGCASA-LPGIYTSVP 244
            .:|:||         |.|:  |:|.||||||||.    |..|.||:|:|.||... :||:||.|.
Human   488 DNMLCAGDTRSGGPQANLH--DACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVT 550

  Fly   245 EIRDWFQ 251
            ...||.:
Human   551 NYLDWIR 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 69/252 (27%)
PLATNP_000921.1 FN1 41..83 CDD:214494
Important for binding to annexin A2 42..52
EGF 86..117 CDD:394967
KR 125..209 CDD:238056
Kringle 215..296 CDD:395005
Tryp_SPc 313..559 CDD:238113 69/253 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.