DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and epsilonTry

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:239 Identity:78/239 - (32%)
Similarity:124/239 - (51%) Gaps:10/239 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDSV--QIQPRIIGGHVSSIKEEKYLVQVTT-SEELCGGSLVKPRWVITAAHCVYNKNKNDFKIY 86
            ||.:  |:..||:||:.:||....|.|.:.. ....||||:.....|||||||:.:....|.||.
  Fly    20 PDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIR 84

  Fly    87 GGASN-QAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGANIETIPLAAQSVPARAL 149
            .|::. ::|  ..:.:|........:|.:|:..|:|.:|:.||: ..::|..|.:|..:....|.
  Fly    85 VGSTYWRSG--GSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNPREGAT 147

  Fly   150 VKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGI-HRITRSMVCAARLYKKDSCDGDSG 213
            ..|||||...:..:...:.:.:|.:.:...:.|.|...|. .:|..:|:||...: ||:|.||||
  Fly   148 AVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAPH-KDACQGDSG 211

  Fly   214 GPLVYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVEQ 256
            ||||...:|.|:||:||||... .||:|..|....:|.:|..|:
  Fly   212 GPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWIERTAEE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 72/220 (33%)
Tryp_SPc 34..253 CDD:238113 72/223 (32%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 72/221 (33%)
Tryp_SPc 31..252 CDD:238113 72/223 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.