DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and zgc:92590

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:225 Identity:73/225 - (32%)
Similarity:115/225 - (51%) Gaps:13/225 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKYLVQVT--TSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQA-- 93
            :||||:..|...:.:.:.:|  ..:..||.||:..||.::||||....|:  ..::.|..|.|  
Zfish    20 KIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHCYLVANR--LTVHLGEHNVAVE 82

  Fly    94 -GPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMI-GANIETIPLAAQSVPARALVKVSGWG 156
             |....|: .:.:...|.:|..||:.|...::|....: ...::.:||............|||||
Zfish    83 EGTEQRIK-AEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQYVQPVPLTTSCSSEGEQCLVSGWG 146

  Fly   157 FLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLY-KKDSCDGDSGGPLVYRG 220
            .|........:.:..:.:|:.:||.|..|:.  .:||::|.||..:. .||:|.||||||::..|
Zfish   147 NLINTGVVYPDVLQCLNLPVLTRAQCEGAYG--WQITKNMFCAGFMEGGKDACQGDSGGPVICNG 209

  Fly   221 QLAGIVSFGYGCA-SALPGIYTSVPEIRDW 249
            :|.|:||:||||| |..||:||.|....||
Zfish   210 ELRGVVSWGYGCADSGYPGVYTEVCRYTDW 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 71/223 (32%)
Tryp_SPc 34..253 CDD:238113 73/224 (33%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 73/225 (32%)
Tryp_SPc 21..243 CDD:238113 73/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.