DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG11313

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:220 Identity:67/220 - (30%)
Similarity:99/220 - (45%) Gaps:31/220 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CGGSLVKPRWVITAAHCV-----YNKNKNDFKIYG--GASNQAG----------PYAVIRTVDYI 105
            |.|||:..|:|:||||||     ..|....|::..  |..|.:.          |..|...|:.|
  Fly   147 CAGSLINNRYVVTAAHCVSAATRARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEI 211

  Fly   106 AIRPDFNRKTLNMDVAALRLNSDM-IGANIETIPLAA----QSVPARALVKVSGWG-FLTADATK 164
            .|...|..:....|:|.:||..:: ...:|..:.|.:    |:..:.....|:||| .||::::.
  Fly   212 RIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSP 276

  Fly   165 TAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLV--YRG--QLAGI 225
            ...::....|   ....|...:..|..:..|.:||....:.|||||||||||:  :.|  .|.||
  Fly   277 VKMKLRVTYV---EPGLCRRKYASIVVLGDSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGI 338

  Fly   226 VSFGYGCASAL-PGIYTSVPEIRDW 249
            ||||..|.|.. |.:||:|.....|
  Fly   339 VSFGLNCGSRFWPAVYTNVLSYETW 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 66/218 (30%)
Tryp_SPc 34..253 CDD:238113 67/220 (30%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 67/220 (30%)
Tryp_SPc 116..364 CDD:214473 67/220 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.