DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and aqrs

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:264 Identity:54/264 - (20%)
Similarity:93/264 - (35%) Gaps:64/264 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDSVQIQPRIIGGHVSSIKEEKYLVQV-TTSEELCGGSLVKPRWVITAAHC--------VYNKNK 80
            |..|::|.|:   ...:.::..|.|.| .....:|.|:|:..|.|:|:.||        :|....
  Fly    58 PKPVEVQKRL---PFDATRDLTYYVNVLNEGSVICAGALISRRMVVTSTHCFQPRRFDLIYEYTA 119

  Fly    81 NDFKIYGGA--SNQAGPYAVI----------RTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGAN 133
            ....|..|.  .:...|:.||          |..:|:|:               |.|::.:....
  Fly   120 KHLSILTGVELDDNPEPHQVIGFFMPVNKNERFTNYVAL---------------LALSNKLDRDK 169

  Fly   134 IETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITR---S 195
            ...|||..:...|...||::.:|     ..|...|:::..|....|.......:.:..::.   .
  Fly   170 YRYIPLHRKKPQAGDDVKMAYYG-----PPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPD 229

  Fly   196 MVCA--ARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGC---------------ASALPGIYTSV 243
            .:|.  .|..||.:|....|.||:...:||.|..:|..|               ...:|.|.|:.
  Fly   230 FICVRNKRHSKKTTCSTRPGDPLLIDNKLAAINIYGEHCDEDDDSTNMDIYLPIRPVIPFIQTAT 294

  Fly   244 PEIR 247
            ..:|
  Fly   295 DALR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 51/256 (20%)
Tryp_SPc 34..253 CDD:238113 50/255 (20%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 44/227 (19%)
Tryp_SPc 83..268 CDD:304450 42/204 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.