DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG15498

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:115 Identity:24/115 - (20%)
Similarity:42/115 - (36%) Gaps:29/115 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVT-----------TSEELCGGSLV-KPR 66
            :||....|.|....|||:|..||.....:.::..::.|.           |..|:|..::. .||
  Fly    51 VLGPPQDVLAFGVVVQIRPVKIGVCRQQVSDQNLVLSVVITQEGLHRNCKTINEMCDLTVAPSPR 115

  Fly    67 WVITAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTL 116
            ..:..:..:.:.|::|                 ||..|:|....|..:.|
  Fly   116 PALRNSFRIVSPNEDD-----------------RTGQYLAYGEKFRLQAL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 16/96 (17%)
Tryp_SPc 34..253 CDD:238113 16/95 (17%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.