DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG31266

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:241 Identity:61/241 - (25%)
Similarity:104/241 - (43%) Gaps:15/241 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HSAVYAHPDSVQIQPRIIGGHVSSIKEEKYL--VQVTTSEELCGGSLVKPRWVITAAHCVYNKNK 80
            |.:..|.|     |.|:|||..::.....::  :|...|..|||..::...||:|||.||.....
  Fly    41 HRSTEAVP-----QGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRP 100

  Fly    81 NDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANI-ETIPLA-AQS 143
            .:..:..|..:....||...||..|.:..:|::...:.|:|.|:|:|.:...:: :.|.|| ...
  Fly   101 LNLLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDE 165

  Fly   144 VPARALVKVSGWGFLTADAT--KTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKD 206
            :.....:..:|||...|..|  :..:......:|:   .:|....:....:....||......:.
  Fly   166 LEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPV---DACREKLQNQDDVDLGHVCVQMDAGQG 227

  Fly   207 SCDGDSGGPLVYRGQ-LAGIVSFGYGCASALPGIYTSVPEIRDWFQ 251
            :|.||:||||:...| |.||.::|..|....|.:|.......||.:
  Fly   228 ACHGDTGGPLIDEQQRLVGIGNWGVPCGRGYPDVYARTAFYHDWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 55/222 (25%)
Tryp_SPc 34..253 CDD:238113 56/225 (25%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 56/223 (25%)
Tryp_SPc 52..275 CDD:238113 56/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439382
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.