DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG10405

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:266 Identity:79/266 - (29%)
Similarity:127/266 - (47%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEE---LCGGSLVKPRWVIT 70
            |.:::.....:||...|||     ||:.|..::  |.::..|::...:   :||.|::...|.||
  Fly    17 LVILEASRTEAAVPRQPDS-----RIVNGREAT--EGQFPYQLSLRRQTVHICGASILSSNWAIT 74

  Fly    71 AAHCV--YNKNKNDFKI-YGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGA 132
            ||||:  :.:...:|.: .|.....:|  ..::.|..|...|.::|..:|.|||.||.....:  
  Fly    75 AAHCIDGHEQQPREFTLRQGSIMRTSG--GTVQPVKAIYKHPAYDRADMNFDVALLRTADGAL-- 135

  Fly   133 NIETIPLA--------------AQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCV 183
               ::||.              ::|:||    .|||||.::......:..:.|..|...::..|.
  Fly   136 ---SLPLGKVAPIRLPTVGEAISESMPA----VVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCH 193

  Fly   184 SAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCASA-LPGIYTSV--PE 245
            :..|....:|.:|.||| ....|:|.||||||:..:|.|.||||:|.|||.. .||:||.:  |.
  Fly   194 NDLRHHGGVTEAMFCAA-ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPT 257

  Fly   246 IRDWFQ 251
            ||.|.:
  Fly   258 IRRWIR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 72/238 (30%)
Tryp_SPc 34..253 CDD:238113 72/241 (30%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 72/239 (30%)
Tryp_SPc 37..263 CDD:238113 72/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.