DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and ea

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:288 Identity:85/288 - (29%)
Similarity:120/288 - (41%) Gaps:88/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKY--LVQVTTSE----ELCGGSLVKPRWVITAAHCVYNKN-KNDFKIYG--- 87
            ||.||..:.|.|..:  |::.|.|:    ..|||||:..|:||||:|||..|. ..|:::.|   
  Fly   127 RIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVRL 191

  Fly    88 ----------------GASNQAGPY---AVIRTVDYIAIRPDFNRKTLNM--DVAALRLNSDMIG 131
                            |..:.|.|:   .|.||:.:    ||:...:.|.  |:|.|||     .
  Fly   192 GEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPH----PDYIPASKNQVNDIALLRL-----A 247

  Fly   132 ANIE--------TIPLAAQSVPARA------LVKVSGWGFLTADATKTAERVHSVLVPMWSRASC 182
            ..:|        .:||   .|..|:      .:.|:|||       ||.:...|.|    ...:.
  Fly   248 QQVEYTDFVRPICLPL---DVNLRSATFDGITMDVAGWG-------KTEQLSASNL----KLKAA 298

  Fly   183 VSAFR-----GIHR-----ITRSMVCAARLYKKDSCDGDSGGPLVYRGQ--------LAGIVSFG 229
            |..||     .::.     :..:.:||......|||.|||||||:....        |||:||||
  Fly   299 VEGFRMDECQNVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFG 363

  Fly   230 -YGCASA-LPGIYTSVPEIRDWFQRVVE 255
             ..|..| .||:||.|.:..||.|..:|
  Fly   364 PTPCGLAGWPGVYTLVGKYVDWIQNTIE 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 81/280 (29%)
Tryp_SPc 34..253 CDD:238113 83/283 (29%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 82/281 (29%)
Tryp_SPc 128..389 CDD:238113 83/283 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.