DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG3916

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:289 Identity:78/289 - (26%)
Similarity:128/289 - (44%) Gaps:59/289 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIARCLTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTS-------EELC 58
            |:...|..:.|:...|....|.:..:|   ..||.||...:   |....||:..       :..|
  Fly     1 MVVLQLFCMLLILRQGLADVVTSTTES---PTRINGGQRVN---ETVPFQVSLQMQRRGRWQHFC 59

  Fly    59 GGSLVKPRWVITAAHCVYNKNKNDFKIYGGASN-QAG-------------PYA----VIRTVDYI 105
            |||:|..:.|:|||||:......|..:..|..| :||             .|:    :|..:..:
  Fly    60 GGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRHRLVTKHVHPQYSMNPRIINDIALV 124

  Fly   106 AIRPDFNRKTLNMDVAALRL-NSDMIGANIETIPLAAQSVPARALVKVSGWGFLTADATKTA--- 166
            .:.|.|..:  ..|::.:.: .||.||   |.:|           |:::||| .|:.:|.:|   
  Fly   125 KVTPPFRLE--RSDISTILIGGSDRIG---EKVP-----------VRLTGWG-STSPSTSSATLP 172

  Fly   167 ERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQ---LAGIVSF 228
            :::.::.....|...|..  :|. |:||:.:||..:..:.:|.|||||||:..|:   |.||||:
  Fly   173 DQLQALNYRTISNEDCNQ--KGF-RVTRNEICALAVQGQGACVGDSGGPLIRPGKQPHLVGIVSY 234

  Fly   229 GYG-CASALPGIYTSVPEIRDWFQRVVEQ 256
            |.. ||...|.:||.|.....:..:|:.|
  Fly   235 GSSTCAQGRPDVYTRVSSFLPYISQVINQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 70/248 (28%)
Tryp_SPc 34..253 CDD:238113 69/251 (27%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 70/249 (28%)
Tryp_SPc 31..260 CDD:238113 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.