DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG17404

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:250 Identity:70/250 - (28%)
Similarity:109/250 - (43%) Gaps:54/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGG- 88
            |..|.:|.|..||.:                ..||||::.|..::|||||....|.:...:..| 
  Fly    48 PYQVSLQYRTRGGQM----------------HFCGGSIIAPNRILTAAHCCQGLNASRMSVVAGI 96

  Fly    89 -ASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAA------LRLNSDMIGANIETIPLAAQSVPA 146
             ..|:.|..:  :.:.| :|.|.: ::.:..|:|.      |:||:..|.| ||........|..
  Fly    97 RGLNEKGSRS--QVLSY-SIHPKY-QELVTSDLAVLSIKPPLKLNNSTISA-IEYRSQGKDFVGG 156

  Fly   147 RALVKVSGWG--------FL-TADATKTAERV--HSVLVPMWSRASCVSAFRGIHRITRSMVCAA 200
            ...|.::|||        || ..:.....:|:  |::     |.:.|.:|  |:..:|.:.:||.
  Fly   157 GVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSYHTI-----SNSECRNA--GMESVTDTEICAR 214

  Fly   201 RLYKKDSCDGDSGGPLVYRG----QLAGIVSFG-YGCASAL-PGIYTSVPEIRDW 249
            ..: :.:|.||||||||...    |..||||:| ..|...: |.:||.|....||
  Fly   215 GPF-RGACSGDSGGPLVMESKNGLQQVGIVSYGLVVCGLYISPDVYTRVSTFSDW 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 65/240 (27%)
Tryp_SPc 34..253 CDD:238113 65/240 (27%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 69/249 (28%)
Tryp_SPc 35..269 CDD:238113 69/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.