DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Sems

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:266 Identity:92/266 - (34%)
Similarity:139/266 - (52%) Gaps:17/266 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSLFLVQILGFHSAVYAHPDSVQI------------QPRIIGGHV-SSIKEEKYLVQVT-TSEE 56
            |..|||:..:..::....|.:::.:            |.|:|||.| ::.|...|||.:. .:..
  Fly     4 LLFLFLLAGILINNHALQHNETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNF 68

  Fly    57 LCGGSLVKPRWVITAAHCVYNK-NKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDV 120
            :|||:|:....|:|||||..:: .|..:.:.||.| :.....:.|.|........|...|:||||
  Fly    69 ICGGTLIHELIVLTAAHCFEDRAEKEAWSVDGGIS-RLSEKGIRRQVKRFIKSAQFKMVTMNMDV 132

  Fly   121 AALRLNSDMIGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSA 185
            |.:.||..|:|.||.|:.|.:.::.....:.|||||....|.......:.:|.||:..:..|..|
  Fly   133 AVVLLNRPMVGKNIGTLSLCSTALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREA 197

  Fly   186 FRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCAS-ALPGIYTSVPEIRDW 249
            :|....|:.||.||:.|.|||:|..||||||||..|:.||||||.|||| ..||:||.|..::.:
  Fly   198 YRESVSISDSMFCASVLGKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPF 262

  Fly   250 FQRVVE 255
            ..:.::
  Fly   263 IVKGIK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 86/219 (39%)
Tryp_SPc 34..253 CDD:238113 85/222 (38%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 86/220 (39%)
Tryp_SPc 44..265 CDD:238113 85/221 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455621
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.