DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG10663

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:253 Identity:85/253 - (33%)
Similarity:120/253 - (47%) Gaps:50/253 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKYLVQVTT--SEELCGGSLVKPRWVITAAHCV----------YNKNKNDFKI 85
            :||||..:...|..:.|.:..  .|..|||:|:.||||:||||||          :|.|..|   
  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEAFCGGTLIAPRWVLTAAHCVRKVLFVRIGEHNLNYED--- 567

  Fly    86 YGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIET------IPLAAQSV 144
              |...|   ..|:::..:    |:|:::|::.|||.|||..   ..|..|      :|...|::
  Fly   568 --GTEIQ---LRVMKSYTH----PNFDKRTVDSDVALLRLPK---AVNATTWIGYSCLPQPFQAL 620

  Fly   145 PARALVKVSGWG-FLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKK--- 205
            |......:.||| ....|||.|:. :|...||:....:|...:.. :.||::|.||.  ::|   
  Fly   621 PKNVDCTIIGWGKRRNRDATGTSV-LHKATVPIIPMQNCRKVYYD-YTITKNMFCAG--HQKGHI 681

  Fly   206 DSCDGDSGGPLVYRG--------QLAGIVSFGYGCASALP-GIYTSVPEIRDWFQRVV 254
            |:|.|||||||:.|.        .:.||.|||.|||.... |||..||...||...||
  Fly   682 DTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWVWSVV 739

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 81/246 (33%)
Tryp_SPc 34..253 CDD:238113 83/249 (33%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 82/247 (33%)
Tryp_SPc 507..735 CDD:238113 82/246 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.