DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG32374

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:276 Identity:79/276 - (28%)
Similarity:137/276 - (49%) Gaps:44/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GFHSAVYAHPDSVQIQPR-IIGGHVS------SIKEEKYL-VQVTTSEE---------------- 56
            |.|..:|..|   :|:|: .:.|::|      :::.:.|| .::...::                
  Fly    34 GTHYLLYEGP---RIKPQTFLPGNISTNPAINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNN 95

  Fly    57 --LCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQ--AGPYAVIRTVDYIAIRPDFNRKTLN 117
              :||..::..||::||.||... |...:.:..|::.|  .|.   :|.|......|:::..|:.
  Fly    96 YFICGCVILNRRWILTAQHCKIG-NPGRYTVRAGSTQQRRGGQ---LRHVQKTVCHPNYSEYTMK 156

  Fly   118 MDVAALRLNSDM-IGANIETIPLAAQSVPARALVK---VSGWGFLTADATKTAERVHSVLVPMWS 178
            .|:..::|.:.: :|..::.:.|  .|...:...|   .||||..:|:|......:..|:|...|
  Fly   157 NDLCMMKLKTPLNVGRCVQKVKL--PSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVS 219

  Fly   179 RASCVSAFRGIH-RITRSMVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCASA-LPGIYT 241
            ||.|...:||.. :|.:.|:||.| ..:|:|.||||||||:.|.|.||.|||.||||| .||:|.
  Fly   220 RAKCQQDYRGTGIKIYKQMICAKR-KNRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYV 283

  Fly   242 SVPEIRDWFQRVVEQH 257
            :|.:...|.::|.:::
  Fly   284 NVLQYTRWIKKVAKKY 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 71/249 (29%)
Tryp_SPc 34..253 CDD:238113 72/251 (29%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 67/225 (30%)
Tryp_SPc 74..295 CDD:238113 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.