DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG16998

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:256 Identity:87/256 - (33%)
Similarity:133/256 - (51%) Gaps:17/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTT-SEELCGGSLVKPRWVI 69
            :.:|.|:.|.| |......|     |.||:||....|....:|..:|. ....|..:|:...|::
  Fly     3 ILALILLLICG-HKTSALSP-----QERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLV 61

  Fly    70 TAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLN-SDMIGAN 133
            ||.|||  :..:.:.:..|::...|. ...|.|..:.:.||||.:||..|:|.|:|: |..:|.|
  Fly    62 TAGHCV--QYPDSYSVRAGSTFTDGG-GQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGN 123

  Fly   134 IETI--PLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHR-ITRS 195
            |:.:  ||.:.::..|.|: |:|||...|..:::..|:...:|.:.::..|...:..:|| ||..
  Fly   124 IQVVKLPLPSLNILPRTLL-VAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDD 187

  Fly   196 MVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVE 255
            |||||.. .:|.|.||||.|||:||...|||||.:|||.. .||:||.:.....|...|:|
  Fly   188 MVCAAGA-GRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFNVLE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 77/221 (35%)
Tryp_SPc 34..253 CDD:238113 77/224 (34%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 77/222 (35%)
Tryp_SPc 25..242 CDD:238113 76/221 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.