DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG14990

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:269 Identity:71/269 - (26%)
Similarity:112/269 - (41%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDSVQI----QPRIIGGHVSSIKEEK---------YLVQVTTSEELCG-GSLVKPRWVITAAHCV 75
            ||..|:    .|   .|.|:::|..|         ::|.:.:..:..| |||:.|..|:|||..|
  Fly    42 PDPNQVCGMSNP---NGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIV 103

  Fly    76 YNKNKNDFKIYGGASNQAGPYAVI----RTVDYIAIRPDFNRKTLNMDVAALRL-NSDMIGANIE 135
            ..|...:..:..|..|.......:    |.|..:....:|:......::|.|.| |...:.::|.
  Fly   104 VGKTDAEIVVRAGEWNTGQRSEFLPSEDRPVARVVQHREFSYLLGANNIALLFLANPFELKSHIR 168

  Fly   136 TIPLAAQS---VPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIH-----RI 192
            ||.|.:|.   ...|.|  |:|||.:..:....:.....:.:||.:||.|....|...     .:
  Fly   169 TICLPSQGRSFDQKRCL--VTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDL 231

  Fly   193 TRSMVCAARLYKKDSCDGDSGGPLV-------YRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDW 249
            ..|::||........|.||.|..|.       .|.:.||||::|.||... :|.:||:|...|||
  Fly   232 PASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQAGIVNWGIGCQEENVPAVYTNVEMFRDW 296

  Fly   250 FQRVVEQHS 258
            ....:.|:|
  Fly   297 IYEHMAQNS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 63/246 (26%)
Tryp_SPc 34..253 CDD:238113 65/249 (26%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 61/234 (26%)
Tryp_SPc 67..297 CDD:214473 60/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.