DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and KLKB1

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:243 Identity:82/243 - (33%)
Similarity:124/243 - (51%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKY----LVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKND-FKIYGGASNQ 92
            ||:||..||..|..:    .|::|....||||||:..:||:|||||.......| ::||.|..|.
Human   401 RIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNL 465

  Fly    93 AG-----PYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARALVK- 151
            :.     |::.|:.   |.|..::.....|.|:|.::|.:.:.....:. |:...|....:.:. 
Human   466 SDITKDTPFSQIKE---IIIHQNYKVSEGNHDIALIKLQAPLNYTEFQK-PICLPSKGDTSTIYT 526

  Fly   152 ---VSGWGFLTADATKTAERVHSVL----VPMWSRASCVSAFRGIHRITRSMVCAARLYK---KD 206
               |:||||     :|....:.::|    :|:.:...|...::. ::||:.||||.  ||   ||
Human   527 NCWVTGWGF-----SKEKGEIQNILQKVNIPLVTNEECQKRYQD-YKITQRMVCAG--YKEGGKD 583

  Fly   207 SCDGDSGGPLV--YRG--QLAGIVSFGYGCA-SALPGIYTSVPEIRDW 249
            :|.||||||||  :.|  :|.||.|:|.||| ...||:||.|.|..||
Human   584 ACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDW 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 80/241 (33%)
Tryp_SPc 34..253 CDD:238113 81/242 (33%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 401..632 CDD:214473 82/243 (34%)
Tryp_SPc 402..632 CDD:238113 81/242 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.