DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and KLKB1

DIOPT Version :10

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:243 Identity:82/243 - (33%)
Similarity:124/243 - (51%) Gaps:38/243 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKY----LVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKND-FKIYGGASNQ 92
            ||:||..||..|..:    .|::|....||||||:..:||:|||||.......| ::||.|..|.
Human   401 RIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNL 465

  Fly    93 AG-----PYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARALVK- 151
            :.     |::.|:.   |.|..::.....|.|:|.::|.:.:.....:. |:...|....:.:. 
Human   466 SDITKDTPFSQIKE---IIIHQNYKVSEGNHDIALIKLQAPLNYTEFQK-PICLPSKGDTSTIYT 526

  Fly   152 ---VSGWGFLTADATKTAERVHSVL----VPMWSRASCVSAFRGIHRITRSMVCAARLYK---KD 206
               |:||||     :|....:.::|    :|:.:...|...::. ::||:.||||.  ||   ||
Human   527 NCWVTGWGF-----SKEKGEIQNILQKVNIPLVTNEECQKRYQD-YKITQRMVCAG--YKEGGKD 583

  Fly   207 SCDGDSGGPLV--YRG--QLAGIVSFGYGCA-SALPGIYTSVPEIRDW 249
            :|.||||||||  :.|  :|.||.|:|.||| ...||:||.|.|..||
Human   584 ACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDW 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 80/241 (33%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 402..632 CDD:238113 81/242 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.