DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG3650

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:257 Identity:93/257 - (36%)
Similarity:139/257 - (54%) Gaps:21/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFLVQ----ILGFHSAVYAHPDSVQIQPRIIGGHVSSIKE-EKYLVQVTTSEEL-CGGSLVKPRW 67
            |||:|    :||..|.        ||||||:||..:::.. ..::|.:...... ||||||....
  Fly     5 LFLLQLTQLLLGLASG--------QIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSH 61

  Fly    68 VITAAHCVYNKNKNDFKIYGGAS--NQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMI 130
            |:|||||:.....:...:.||.|  :|:|   |:|.|....|...|:..:||.||..:||.|.:.
  Fly    62 VVTAAHCLKGYQASRITVQGGVSKLSQSG---VVRRVARYFIPNGFSSSSLNWDVGVIRLQSALT 123

  Fly   131 GANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRS 195
            |:.|.||||..........::|||||......:..:.::.:|.:.:..:..|..|::|...:|.|
  Fly   124 GSGITTIPLCQVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTAS 188

  Fly   196 MVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVEQ 256
            ..| ||...||||.|||||.::::.||.||||:|.|||:| .||:||||..:|.:..|.:::
  Fly   189 TFC-ARTGGKDSCSGDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFILRSIKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 81/220 (37%)
Tryp_SPc 34..253 CDD:238113 80/223 (36%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 81/221 (37%)
Tryp_SPc 26..243 CDD:238113 80/220 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.