DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG13430

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:245 Identity:83/245 - (33%)
Similarity:130/245 - (53%) Gaps:21/245 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VQIQPRIIGG---HVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGA 89
            |:...||:||   |::....:..| |:.| ...|||:::.|..::||||||...:|..:.:....
  Fly    26 VEQDGRIVGGWETHITFFPHQVSL-QLGT-RHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAG 88

  Fly    90 SN---QAGPYAVIRTVDYIAIRPDFNRKT-LNMDVAALRLNSDMI-GANIETIPLAAQS--VPAR 147
            |:   :.|.|  || |..|...|:|:..| :|.|:|.::|...:: ..:|..|.||...  :...
  Fly    89 SSDWTKGGSY--IR-VKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPT 150

  Fly   148 ALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCA-ARLYKKDSCDGD 211
            |.:.|||||..:....:..:|:...:|.:..:..|...:.|...:|.:|.|| .:...:|||.||
  Fly   151 AQLFVSGWGSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGD 215

  Fly   212 SGGPLVY----RGQLAGIVSFGYGCASAL-PGIYTSVPEIRDWFQRVVEQ 256
            ||||||.    |.:|.||||:|:|||:|: |||||.|....||..:.:|:
  Fly   216 SGGPLVTSIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 79/231 (34%)
Tryp_SPc 34..253 CDD:238113 80/234 (34%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 80/232 (34%)
Tryp_SPc 32..262 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.