DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG32269

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:229 Identity:93/229 - (40%)
Similarity:132/229 - (57%) Gaps:2/229 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASN 91
            |.:||.||:||..::|....|:||:.....||.|||:..:||:||||||...:.:||.:.||.:.
  Fly   102 SSKIQSRIVGGTSTTISTTPYIVQLRRGSNLCSGSLITEQWVLTAAHCVKGYSASDFTVRGGTTT 166

  Fly    92 QAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARALVKVSGWG 156
            ..|...|.|:|..|.:.|.|..|.:|||.|.|:||..:.|.||.||.:......|.:.|:::|||
  Fly   167 LDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNIGTISMGNYRPKAGSRVRIAGWG 231

  Fly   157 FLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQ 221
            .....:|..::.:.:..:.:..:..|...:||...||:.|:| ||...||||.||||||:.....
  Fly   232 VTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLC-ARAAGKDSCSGDSGGPVTRNNT 295

  Fly   222 LAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVV 254
            |.||||||||||.| .||:||:|..||.|...::
  Fly   296 LLGIVSFGYGCARAGYPGVYTAVVAIRQWATNIM 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 89/216 (41%)
Tryp_SPc 34..253 CDD:238113 89/219 (41%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 89/216 (41%)
Tryp_SPc 121..324 CDD:238113 84/203 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455613
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.