DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG32270

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:226 Identity:85/226 - (37%)
Similarity:128/226 - (56%) Gaps:12/226 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PRIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQAGP 95
            |||:|||.|.:..:.::|.:...... ||||||.||.|:|||||:.:.|.:||.:.||.:..:. 
  Fly    29 PRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSD- 92

  Fly    96 YAVIRTVDYI--AIRPD-FNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARALVKVSGWGF 157
               :|...|:  .:.|. ::|.||:.|||.|:|...:..:..:.|.||.:|....:.|:|||||.
  Fly    93 ---MRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQASIAKPISLAVRSPRPGSFVRVSGWGL 154

  Fly   158 LTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLV-YRGQ 221
            ..:.:|....::.||.|.:..:..|...:||...||.||.||:....||:|.||||||:| ..|.
  Fly   155 TDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGI 219

  Fly   222 LAGIVSFG--YGCASA-LPGIYTSVPEIRDW 249
            |.|:||:|  :.||:. .||:|:.|..:.||
  Fly   220 LVGVVSWGRAHRCAARDSPGVYSDVSYLSDW 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 82/223 (37%)
Tryp_SPc 34..253 CDD:238113 83/224 (37%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 84/225 (37%)
Tryp_SPc 31..254 CDD:238113 83/224 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455627
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.