DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG30414

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:268 Identity:75/268 - (27%)
Similarity:117/268 - (43%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNKN--------KNDF----- 83
            |.|.||..:.:....::|:| ..|:||||||:..|:|:|||||:.:.:        |..|     
  Fly    39 PMITGGADAGLFSNPWMVKV-LGEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDC 102

  Fly    84 -----KIYGGASNQAGPY-------------AVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMI 130
                 |.|.....:.|.|             :....||...:..|:| ..|:.|:..||:.|.:.
  Fly   103 SRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYN-LNLDNDIGLLRMKSFVQ 166

  Fly   131 GAN-IETIPLAAQSVPARA-LVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRIT 193
            .:: :..|.|..:...|.: :..::||| :|.|.| .:.|:....|.......|.|.|  ..::.
  Fly   167 YSDYVRPICLLVEGHMAESPIFNITGWG-VTNDGT-PSRRLQRATVYNTDLHFCRSKF--TKQVD 227

  Fly   194 RSMVCAARLYKKDSCDGDSGGPLVYRGQLA--------GIVSFGYGCASALPGIYTSVPEIRDWF 250
            .|.:|||.. ..|:|.|||||||..:...|        |:||:|.....:. .:||:|...|||.
  Fly   228 ESQICAAGT-NSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSF-SVYTNVTHHRDWI 290

  Fly   251 QRVVEQHS 258
            ...:|..|
  Fly   291 VNAIEDFS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 70/256 (27%)
Tryp_SPc 34..253 CDD:238113 72/259 (28%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 71/256 (28%)
Tryp_SPc 41..290 CDD:238113 71/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.