DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG9294

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:247 Identity:75/247 - (30%)
Similarity:115/247 - (46%) Gaps:43/247 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPRWVITAAHCV--------------YNKNKND 82
            :|:||..:.:.:..::..:...... |.|||:...:|:||||||              :|::.::
  Fly   100 KIVGGQETRVHQYPWMAVILIYNRFYCSGSLINDLYVLTAAHCVEGVPPELITLRFLEHNRSHSN 164

  Fly    83 FKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNS--DMIGANIETIPLAAQSVP 145
            ..|           .:.|.|..:.:...:|.::.:.|:|.||||.  ||....:..|.|..||..
  Fly   165 DDI-----------VIQRYVSRVKVHELYNPRSFDNDLAVLRLNQPLDMRHHRLRPICLPVQSYS 218

  Fly   146 -ARALVKVSGWGFLTAD--ATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYK--K 205
             ...|..|:|||.....  .|.|...|..|::|. |.....:.:|. .:||.:|:||..:.:  |
  Fly   219 FDHELGIVAGWGAQREGGFGTDTLREVDVVVLPQ-SECRNGTTYRP-GQITDNMMCAGYISEGGK 281

  Fly   206 DSCDGDSGGPLVY-------RGQLAGIVSFGYGCA-SALPGIYTSVPEIRDW 249
            |:|.|||||||..       :.|||||||:|.||| ...||:||.|.:...|
  Fly   282 DACSGDSGGPLQTTFDEQPGQYQLAGIVSWGVGCARPQSPGVYTRVNQYLRW 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/245 (30%)
Tryp_SPc 34..253 CDD:238113 75/246 (30%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 74/245 (30%)
Tryp_SPc 101..334 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.