DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and tpr

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:244 Identity:73/244 - (29%)
Similarity:121/244 - (49%) Gaps:23/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IQPRIIGGHVSSIKEEKYLVQVTTSEEL-CGGSLVKPRWVITAAHCVY--NKNKNDFKIYGGASN 91
            ||.||:||..:.:.:..::..:...... |..||:..::::||:||||  .|.:...::......
  Fly   123 IQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFRKERISVRLLEHDRK 187

  Fly    92 QAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIETIPLAAQSVPARALVK----V 152
            .:....:.|.|..:...|.:|.:..:.|:|.::|: :.:..| |.:.......|.|:...    |
  Fly   188 MSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLD-EPVEFN-EVLHPVCMPTPGRSFKGENGIV 250

  Fly   153 SGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYK---KDSCDGDSGG 214
            :|||.|.... .|::.:..|.||:.|:..|..:..| ::||.:|:|..  |.   ||||.|||||
  Fly   251 TGWGALKVGG-PTSDTLQEVQVPILSQDECRKSRYG-NKITDNMLCGG--YDEGGKDSCQGDSGG 311

  Fly   215 PL--VYRG----QLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVEQ 256
            ||  |..|    |:||:||:|.|||.| .||:|..|.....|.:.:.:|
  Fly   312 PLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKNLTKQ 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 69/232 (30%)
Tryp_SPc 34..253 CDD:238113 69/235 (29%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 69/233 (30%)
Tryp_SPc 127..356 CDD:238113 69/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.