DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Ser8

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:252 Identity:83/252 - (32%)
Similarity:131/252 - (51%) Gaps:11/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSLFLVQILGFHSAVY---AHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTS-EELCGGSLVKPR 66
            |.:.||..:...:.||.   ..|.:..:..||:||..|||::..:.|.:..| ...||||::...
  Fly     4 LIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNN 68

  Fly    67 WVITAAHCVYNKNK-NDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM- 129
            .::|||||:..... ::.:|..| ||:.....|:..|..|.....:|..:...|:..:||.:.: 
  Fly    69 IIVTAAHCLDTPTTVSNLRIRAG-SNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLT 132

  Fly   130 IGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHR-IT 193
            .|:.|:.|.:|:.:....:...:||||..:.|...:|..:. |...:..|:.|.|:..|... |.
  Fly   133 FGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLF-VDTRIVGRSQCGSSTYGYGSFIK 196

  Fly   194 RSMVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDW 249
            .:|:|||.. .||:|.||||||||..|||.|:||:|..||.| .||:|.::.|:|||
  Fly   197 ATMICAAAT-NKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDW 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 75/220 (34%)
Tryp_SPc 34..253 CDD:238113 76/221 (34%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 77/222 (35%)
Tryp_SPc 35..253 CDD:238113 76/221 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.