DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and iotaTry

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:250 Identity:77/250 - (30%)
Similarity:119/250 - (47%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLV--QVTTSEELCGGSLVKPRWV 68
            :.::.::.:||..|       .|:...|||||....|:...:.|  |::...| |||.:.....:
  Fly     7 VATVLVLLLLGDAS-------DVEATGRIIGGSDQLIRNAPWQVSIQISARHE-CGGVIYSKEII 63

  Fly    69 ITAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGA 132
            |||.||::.::....|:..||.|......::....| .:...|:.:.|:.|:|.|||::.: .|.
  Fly    64 ITAGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAY-KVHEQFDSRFLHYDIAVLRLSTPLTFGL 127

  Fly   133 NIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSA--FRGIHRITRS 195
            :...|.||:.|......|.|:|||.  .|....::.:....:.:..|..|.|.  ..|...:...
  Fly   128 STRAINLASTSPSGGTTVTVTGWGH--TDNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEE 190

  Fly   196 MVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCA-SALPGIYTSVPEIRDW 249
            .:|||.. ..|:|.||||||||...||.||||:||.|| ...||:|..|..:|.|
  Fly   191 TICAAST-DADACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPW 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 72/221 (33%)
Tryp_SPc 34..253 CDD:238113 71/221 (32%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 72/222 (32%)
Tryp_SPc 28..247 CDD:238113 71/221 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.