DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and thetaTry

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:241 Identity:87/241 - (36%)
Similarity:123/241 - (51%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DSVQIQPRIIGGHVSSIKEEKYLV--QVTTSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGG 88
            |..:.:.||:||..::|....|.|  |..:....|||||:....|:|||||:..:..:...:..|
  Fly    27 DPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDTVVTAAHCLVGRKVSKVFVRLG 91

  Fly    89 AS--NQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGA-NIETIPLAAQSVPARALV 150
            ::  |:.|....:|.:.|   ..|:|.||:..||..|:|:..:... ||..|.||.::.|.....
  Fly    92 STLYNEGGIVVAVRELAY---NEDYNSKTMEYDVGILKLDEKVKETENIRYIELATETPPTGTTA 153

  Fly   151 KVSGWG----FLTADATKTAERVHSVLVPMWSRASCVS-AFRGIHRITRSMVCAARLYKKDSCDG 210
            .|:|||    |......||.:.|:..:|. |.  :|.| .::....|..|||||.. .|||:|.|
  Fly   154 VVTGWGSKCYFWCMTLPKTLQEVYVNIVD-WK--TCASDEYKYGEIIYDSMVCAYE-KKKDACQG 214

  Fly   211 DSGGPLVYRGQLAGIVSFGYGCAS-ALPGIYTSVPEIRDWFQRVVE 255
            ||||||.....|.||||:||.||| .|||:|:.||.:|.|.....|
  Fly   215 DSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWILNASE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 84/226 (37%)
Tryp_SPc 34..253 CDD:238113 84/229 (37%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 84/227 (37%)
Tryp_SPc 35..255 CDD:238113 83/226 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.