DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG8738

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:273 Identity:74/273 - (27%)
Similarity:121/273 - (44%) Gaps:35/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEE--LCGGSLVKPRWVITAA 72
            ||::..|     |::|..:..|........|...|..::|.:...|.  :|||:|:.|:.|:|:|
  Fly   183 FLLKGCG-----YSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSA 242

  Fly    73 HCVYNKNKNDFKIYGG-----ASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSD-MIG 131
            |.|:|::::...:..|     :..:..||. :|.:..:....:||..||..|:|.:.|... .:.
  Fly   243 HNVFNRSEDSLLVRAGDWDLNSQTELHPYQ-MRAISELHRHENFNNLTLYNDIALVVLERPFQVA 306

  Fly   132 ANIETIPLAAQSVP------ARALVKVSGWGFLTADATKTAER-VHSVLVPMWSRASCVSAFRGI 189
            .:|:.|.|.....|      ..|....:||| |....::|.|. :..:.:|.....||....|..
  Fly   307 PHIQPICLPPPETPQMEAELRSASCLATGWG-LRYSTSRTMENLLKRIELPAVDHESCQRLLRHT 370

  Fly   190 -----HRITRSMVCAARLYKKDSCDGDSGGPLVY-------RGQLAGIVSFGYGCASA-LPGIYT 241
                 :.:..|..||..:..||:|.||.|.||..       |.||.|:||:|..||.. :|..||
  Fly   371 VLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYT 435

  Fly   242 SVPEIRDWFQRVV 254
            :|..:|:|....|
  Fly   436 NVAYLRNWIDEQV 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 66/243 (27%)
Tryp_SPc 34..253 CDD:238113 67/246 (27%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 67/241 (28%)
Tryp_SPc 207..444 CDD:214473 66/238 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.