DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG17571

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:250 Identity:80/250 - (32%)
Similarity:127/250 - (50%) Gaps:14/250 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSE--ELCGGSLVKPRWVITA 71
            |.:|.::...::.:.:|.......||:.|....|:...|.|.|.|::  ..|||||:....|:||
  Fly     6 LSVVALVALAASCHGNPGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLIDSETVLTA 70

  Fly    72 AHCVYNKNKNDFKIYGGASNQA--GPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGAN 133
            |||:.:...::.::..|:::::  |....:|...|   ...:|.|.:..|||.::|:|.: ..:.
  Fly    71 AHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKY---HEGYNSKLMINDVAIIKLSSPVRQTSK 132

  Fly   134 IETIPLAAQSVPARALVKVSGWG---FLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRS 195
            |..|.||.....:.....|||||   ||...:..|.::|...|:.....|:....: |...|..:
  Fly   133 IRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNY-GSDSILET 196

  Fly   196 MVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCA-SALPGIYTSVPEIRDW 249
            ||||.. .|||:|.||||||||...:|.|:||:|.||| :..||:|..|..:|.|
  Fly   197 MVCATG-EKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSW 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 76/224 (34%)
Tryp_SPc 34..253 CDD:238113 75/224 (33%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 76/225 (34%)
Tryp_SPc 31..254 CDD:238113 75/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.