DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG18563

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_609841.2 Gene:CG18563 / 35050 FlyBaseID:FBgn0032639 Length:379 Species:Drosophila melanogaster


Alignment Length:245 Identity:68/245 - (27%)
Similarity:108/245 - (44%) Gaps:48/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VSSIKEEKYLVQVTTSEELCGGSLVKPRWVITAAHCVYNK-NKNDFKIYGG-----ASNQAGPYA 97
            |:...||.||.         ||||:.|:.::||||...|| |::...:..|     .:|:...|.
  Fly   149 VALFYEEVYLT---------GGSLISPKVILTAAHNTMNKMNEDRIVVRAGEFVMNTTNEPIQYE 204

  Fly    98 VIRTVDYIAIRPDFNRKTLNMDVAALRLN-----SDMIGANIETIPLAAQSVPARALVKVSGWGF 157
            . |.|:.|.....|..::...:||.:.:.     :|.||  :.|:|....|...|... |:||..
  Fly   205 E-RVVERIVRHEGFIFQSGINNVALIFVKTPFVLNDRIG--VLTLPSRQASFEGRRCT-VAGWDL 265

  Fly   158 LTADATKTAERVHSVLVPMWSRASCVSAFRG--------IHRITRSMVCAARLYKKDSCDGDSG- 213
            :::........:..:.:.:..|.:||:.||.        :|   .|::||.....:|.|.|..| 
  Fly   266 VSSHDQSRMRIIKKLELTVLDRTTCVAQFRNTTLGRNFDLH---PSLICARSEINRDFCFGGGGY 327

  Fly   214 ---------GPLVYRGQLAGIVSFGYGCASALPGIYTSVPEIRDW-FQRV 253
                     .|.|:  :.||||::|.||...||||||:|...|.| :.|:
  Fly   328 ALFCSLGDENPHVF--EQAGIVAWGMGCGLDLPGIYTNVAMFRSWIYNRI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 66/238 (28%)
Tryp_SPc 34..253 CDD:238113 67/243 (28%)
CG18563NP_609841.2 Tryp_SPc 147..373 CDD:238113 67/241 (28%)
Tryp_SPc 147..371 CDD:214473 66/239 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.