DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG4793

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:264 Identity:66/264 - (25%)
Similarity:104/264 - (39%) Gaps:55/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GHVSSI---------------KEEKYLVQVTTSEE---LCGGSLVKPRWVITAA---------HC 74
            |||:.|               .|..::|.:..|..   |.||||:....|:|::         :.
  Fly    87 GHVNRIGVGFTITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTLEVPEKYL 151

  Fly    75 VYNKNKNDFKIYGGASNQAGPYAVIRTV---DYIAIRPDFNRKTLNMDVAALRLNSDMIGANIET 136
            :....:.||:..  ...:|.....||.:   ..:::....|...|......|:|:        ..
  Fly   152 IVRAGEWDFESI--TEERAHEDVAIRKIVRHTNLSVENGANNAALLFLARPLKLD--------HH 206

  Fly   137 IPLAAQSVPARALVK----VSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHR----IT 193
            |.|.....|.|..:.    |||||..||........:..:.:|:..|:.|.:..:|.:.    :.
  Fly   207 IGLICLPPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQGPYGKDFILD 271

  Fly   194 RSMVCAARLYKKDSCDGDSGGPLV-------YRGQLAGIVSFGYGCASALPGIYTSVPEIRDWFQ 251
            .|::||.....||:|.||.|.||.       .|.:|.|||:||:||...||..||.|.:||.|..
  Fly   272 NSLICAGGEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGPLPAAYTDVSQIRSWID 336

  Fly   252 RVVE 255
            ..::
  Fly   337 NCIQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 65/256 (25%)
Tryp_SPc 34..253 CDD:238113 66/260 (25%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 62/241 (26%)
Tryp_SPc 105..335 CDD:214473 61/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.