DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:263 Identity:79/263 - (30%)
Similarity:119/263 - (45%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PDSVQIQPRIIGGHVSSIKEEKYL-VQVTTSEELCGGSLVKPRWVITAAHCV------------- 75
            ||    |.||:||..:|..|..:: |...:.::.|||||:....::||||||             
  Fly   395 PD----QERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCVARMTSWDVAALTA 455

  Fly    76 ----YNKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIGANIET 136
                ||.. .||::          ..|.|.:..:.....|...||:.|||.|.| |:.:....|.
  Fly   456 HLGDYNIG-TDFEV----------QHVSRRIKRLVRHKGFEFSTLHNDVAILTL-SEPVPFTREI 508

  Fly   137 IPLAAQSVPAR-------ALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAF--RGIHRI 192
            .|:...:.|::       .:..|:|||.|..:..:.: .:..|.:|:|:.|.|...:  .....|
  Fly   509 QPICLPTSPSQQSRSYSGQVATVAGWGSLRENGPQPS-ILQKVDIPIWTNAECARKYGRAAPGGI 572

  Fly   193 TRSMVCAARLYKKDSCDGDSGGPLVY----RGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQR 252
            ..||:||.:. .||||.||||||:|.    |....||||:|.||... .||:||.|..:..|..:
  Fly   573 IESMICAGQA-AKDSCSGDSGGPMVINDGGRYTQVGIVSWGIGCGKGQYPGVYTRVTSLLPWIYK 636

  Fly   253 VVE 255
            .::
  Fly   637 NIK 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 75/247 (30%)
Tryp_SPc 34..253 CDD:238113 75/250 (30%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 75/248 (30%)
Tryp_SPc 400..637 CDD:238113 75/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.