DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Phae1

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:262 Identity:70/262 - (26%)
Similarity:109/262 - (41%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVT-TSEELCGGSLVKPRWVITAA 72
            |.|:.|..........|:.     |::||..:::....|.|.:. .....|..|::...|::|||
  Fly    16 LLLLGICRISGVAIGAPEG-----RVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAA 75

  Fly    73 HCVYNKNKNDFKIYGGASNQAGPYAV--------IRTVDYIAIRPDFNRKTLNMDVAALRLNSDM 129
            ||:.|.|:     ..|::..||..||        .|::.|..|...:...|:..|:..:...:..
  Fly    76 HCLTNSNQ-----VLGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAF 135

  Fly   130 I-GANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVL----VPMWSRASCVSAF--R 187
            : .|.:..:.|.:..|.......:.|||  :...|.||....::.    ||:.|.:||.||.  :
  Fly   136 VWSAAVAPVTLPSSGVVPTGTANLYGWG--STSTTNTASYPSTLQVATNVPIISLSSCESALGTK 198

  Fly   188 G--IHRITRSMVCAARLYKKDS-CDGDSGGPLVYRGQLAGIVSFG-YGCASA-LPGIYTSVPEIR 247
            |  :|   .:.:|...|....| |..|||||||....|.||||:| ..|..| .|.:|..|....
  Fly   199 GSDVH---STNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFI 260

  Fly   248 DW 249
            .|
  Fly   261 SW 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 65/236 (28%)
Tryp_SPc 34..253 CDD:238113 65/237 (27%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 66/238 (28%)
Tryp_SPc 36..266 CDD:238113 65/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455667
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.