DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Try29F

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:261 Identity:92/261 - (35%)
Similarity:133/261 - (50%) Gaps:15/261 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IARCLTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPR 66
            :|:.:..||:..||..:.::.|.....::..||:||.|::||:..|.|.:..|...|||||:...
  Fly    10 MAKTILHLFIGGILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRSYHFCGGSLIAQG 74

  Fly    67 WVITAAHCVYNKNKNDFKIYGGASNQA--GPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDM 129
            ||:|||||.........|:..|:|..:  |....|:.|..   .|.|:..|::.|.:.|.| .:.
  Fly    75 WVLTAAHCTEGSAILLSKVRIGSSRTSVGGQLVGIKRVHR---HPKFDAYTIDFDFSLLEL-EEY 135

  Fly   130 IGANIET----IPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIH 190
            ...|:..    :|.....:.....|.||||| .|..|.:|:..:.||.||..|:..|..|:....
  Fly   136 SAKNVTQAFVGLPEQDADIADGTPVLVSGWG-NTQSAQETSAVLRSVTVPKVSQTQCTEAYGNFG 199

  Fly   191 RITRSMVCAARLYK--KDSCDGDSGGPLVYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQR 252
            .||..|:||. |.:  ||:|.|||||||...|.|.|:||:|||||.. .||:|:.|..:|||...
  Fly   200 SITDRMLCAG-LPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWISS 263

  Fly   253 V 253
            |
  Fly   264 V 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 83/224 (37%)
Tryp_SPc 34..253 CDD:238113 84/227 (37%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 84/225 (37%)
Tryp_SPc 42..264 CDD:238113 84/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.