DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG4271

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:201 Identity:56/201 - (27%)
Similarity:92/201 - (45%) Gaps:9/201 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAA 122
            |||:::..|.|:|||.||.||......:..|..:   .|...|.:...|:....|.|..:.|:|.
  Fly    44 CGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPD---IYRGGRIIRVTALVVHENYKNWDNDIAL 105

  Fly   123 LRLNSDMIGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFR 187
            |.|...::...:..||||.:..........:|||....::.....::.:.:..:..|:.|.... 
  Fly   106 LWLEKPVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVTKIRPRSMCAEEL- 169

  Fly   188 GIHRITRSMVCAARLY-KKDSCDGDSGGPLVYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWF 250
             :..:...::||  .| :.|.|.||.|||||...::.||...|:||..| ||.:||:|....:|.
  Fly   170 -VEPVGEELLCA--FYTENDICPGDYGGPLVLANKVVGIAVQGHGCGFAVLPSLYTNVFHYLEWI 231

  Fly   251 QRVVEQ 256
            :...|:
  Fly   232 EENAEK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 54/192 (28%)
Tryp_SPc 34..253 CDD:238113 55/196 (28%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 55/196 (28%)
Tryp_SPc 19..231 CDD:214473 54/193 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.