DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Ser12

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:236 Identity:84/236 - (35%)
Similarity:118/236 - (50%) Gaps:26/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKYLVQVTTSEE-LCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGA--SNQAG 94
            ||:|||...|.|..:...:..||: :||..:...:.:|||||||.......:.:..|:  .|..|
  Fly    23 RIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSVWKNLGG 87

  Fly    95 PYAVIRTV----DYIAIRPDFNRKTLNMDVAALRLNSDMI-GANIETIPLAAQSVPARALVKVSG 154
            .:|.:..:    ||::....||      |:|.:||...:| .|.:..|.||..:..|.....|||
  Fly    88 QHARVAVIRKHEDYVSSTILFN------DIAVIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSG 146

  Fly   155 W---GFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPL 216
            |   |.|....|...:....:|.|...:       |....||::|:|||.|. ||||.|||||||
  Fly   147 WGEIGILWLQPTSLLKTSVKILDPNVCK-------RSYQYITKTMICAAALL-KDSCHGDSGGPL 203

  Fly   217 VYRGQLAGIVSFGYGCASA-LPGIYTSVPEIRDWFQRVVEQ 256
            |..|||.||||:|.|||:. .||:|.:|.|::.|....:||
  Fly   204 VSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 81/227 (36%)
Tryp_SPc 34..253 CDD:238113 81/230 (35%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 81/228 (36%)
Tryp_SPc 24..238 CDD:238113 80/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.