DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Ser6

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:283 Identity:80/283 - (28%)
Similarity:127/283 - (44%) Gaps:57/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IARCLTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVT---TSEELCGGSLV 63
            :|..|.|..|..:|...||    |.  ::..|::||. .::|.: :..||:   .....||||::
  Fly     6 VAILLCSFLLFLVLPVQSA----PG--KLNGRVVGGE-DAVKNQ-FPHQVSLRNAGSHSCGGSIL 62

  Fly    64 KPRWVITAAHCVYNKNKND---------FKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLNMD 119
            ...:::||||||.|::.|.         |.|..|::::.....:::..:.| :..::. ..|| |
  Fly    63 TRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVI-VHEEYG-NFLN-D 124

  Fly   120 VAALRLNSDMI-GANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCV 183
            ||.|||.|.:| .|:|:.|.|.....||...|.:||||.:.          |...:|.:.:    
  Fly   125 VALLRLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIK----------HQGDLPRYLQ---- 175

  Fly   184 SAFRGIHRITRSM------------VCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGY-GCASA 235
              :..:..|||..            :|........:|:||||||.||..||.|:..|.. ||.|.
  Fly   176 --YNTLKSITRQQCEELIDFGFEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGST 238

  Fly   236 LPGIYTSVPEIRDWFQRVVEQHS 258
            .|..|..|...:||    :::||
  Fly   239 YPDGYARVFYFKDW----IKKHS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 68/241 (28%)
Tryp_SPc 34..253 CDD:238113 69/244 (28%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 70/246 (28%)
Tryp_SPc 32..256 CDD:238113 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.