DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG4653

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:264 Identity:66/264 - (25%)
Similarity:108/264 - (40%) Gaps:53/264 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVTTSEELCGGSLVKPRWVIT 70
            :.:|.:||.....:.|.:.|.|:.:  |..|.||                  |||:|::.:|::|
  Fly    18 IVTLGVVQSSRLPAEVGSQPHSISL--RRNGVHV------------------CGGALIREKWILT 62

  Fly    71 AAHCV-------------YNKNKNDF-KIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTL--NMD 119
            |||||             ||...... ::.||   |..|      :..|.|..:::....  :.|
  Fly    63 AAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGG---QLVP------LSKIIIHTNYSSSDAVGSND 118

  Fly   120 VAALRLNSDMI-GANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCV 183
            :|.|.|.:.:: .||...|.||.:...|.:.:..||||....|.:.:    |.:.|......|..
  Fly   119 LALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLS----HVLQVATRQSLSAS 179

  Fly   184 SAFRGIHRITRSMVCAARLYKKDS--CDGDSGGPLVYRGQLAGIVSFGY-GCASALPGIYTSVPE 245
            .....::.....::|.:.:.:..:  |.||:|.|..|..||.||.:|.. ||.|..|..|..|.:
  Fly   180 DCQTELYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQ 244

  Fly   246 IRDW 249
            ..:|
  Fly   245 HLEW 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 59/235 (25%)
Tryp_SPc 34..253 CDD:238113 59/236 (25%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 63/252 (25%)
Tryp_SPc 30..249 CDD:214473 63/252 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.