DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG9676

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:254 Identity:85/254 - (33%)
Similarity:129/254 - (50%) Gaps:26/254 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLVQVT---TSEELCGGSLVKPRWV 68
            |||.::...|    |.|..||| ::|||:||  :..:|.::..|::   .....||||::...:|
  Fly     6 TSLLVLCAAG----VLAQNDSV-VEPRIVGG--TKAREGQFPHQISLRRRGSHTCGGSIISKDYV 63

  Fly    69 ITAAHCVYNKNK----NDFKIYGGA--SNQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRL-N 126
            :||||||...|.    |:.:|..|:  .:..|....:.||   .:.|::|..  ..|||.||| |
  Fly    64 VTAAHCVKQGNNVAPANELEIQAGSLLLSSGGVRVPVATV---TVHPNYNSN--GHDVAVLRLRN 123

  Fly   127 SDMIGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHR 191
            |....:||..|.||.:..|..|.|.:||||.::.....:...:: |.|...||.||...:  :.:
  Fly   124 SLTFNSNIAAIKLATEDPPNDATVDISGWGAISQRGPISNSLLY-VQVKALSRESCQKTY--LRQ 185

  Fly   192 ITRSMVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGY-GCASALPGIYTSVPEIRDW 249
            :..:.:|......|.:|.||||||..|:|:|.|:.||.. ||..|.|..|..|.::|:|
  Fly   186 LPETTMCLLHPKDKGACYGDSGGPATYQGKLVGLASFVIGGCGRAAPDGYERVSKLRNW 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/226 (33%)
Tryp_SPc 34..253 CDD:238113 74/227 (33%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 75/228 (33%)
Tryp_SPc 28..248 CDD:238113 74/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.