DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG33159

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:230 Identity:88/230 - (38%)
Similarity:130/230 - (56%) Gaps:10/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKYLVQVTTSEE-LCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGAS--NQAG 94
            ||:||..::|.|..|||.:..:.. :|||||:..|.|::||||||......|.::.|||  :|..
  Fly    25 RIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVYGSQPEGFTVHAGASRLDQEA 89

  Fly    95 PYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMI--GANIETIPLAAQSVPARALVKVSGWGF 157
            |  |:|.|......|.::....:||||.|:|...::  ...:.||..........|..::||||.
  Fly    90 P--VVRNVVMFHTSPSYSATNFDMDVALLQLQEVVVLTPGKVATISPCRNPPEGNAYARISGWGV 152

  Fly   158 LTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQL 222
            ...:..:.||:|.:.:|.:...|.|..::.|..:::.||:|||....:|||.||||||||||||:
  Fly   153 TRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVRGLRDSCSGDSGGPLVYRGQV 217

  Fly   223 AGIVSFGYGCA-SALPGIYTSVPEIRDWFQRVVEQ 256
            .||||:|:||| .:.||:||:|...|  ....:||
  Fly   218 CGIVSWGFGCARPSFPGVYTNVASER--VHEFIEQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 86/221 (39%)
Tryp_SPc 34..253 CDD:238113 85/224 (38%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 85/217 (39%)
Tryp_SPc 26..251 CDD:238113 87/229 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455619
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.