DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG31681

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:266 Identity:86/266 - (32%)
Similarity:137/266 - (51%) Gaps:19/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIARCLTSLFLVQILGFHSAV-YAHPDSVQIQPRIIGGHVSSIKEEKYLVQV-TTSEELCGGSLV 63
            |..|.|.|: ||.|.|...|. ...|:.     ||:||....|:...:.|.| ..|...|||.:.
  Fly     1 MCLRLLLSI-LVSIAGLACAARIPGPEE-----RIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIY 59

  Fly    64 KPRWVITAAHCVYNKNKNDFKIYGGASNQAGPYAVIRTVDYIAIRPDFNRKTLN-MDVAALRLNS 127
            ..|.::|||||:.|....|..:..|:|..:....|::.:..|| .|.:..|..| .|:|.|.|.:
  Fly    60 SDRAILTAAHCLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIA-HPKYVPKLYNPYDIAVLILEA 123

  Fly   128 DM-IGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHR 191
            .: :|..::.||||.|:..|..:|..||||:...:::.....:..|.|.:.:|..|:.|::.:: 
  Fly   124 PLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVN- 187

  Fly   192 ITRSMVCAARLYKKDSCDGDSGGPLV--YRG---QLAGIVSFGYGCASALPGIYTSVPEIRDWFQ 251
            ||..|:||.. .:.|:|.|||||||:  .:|   ||.|:||:|.||.:. ||:|..:....:|.:
  Fly   188 ITIDMICADG-QRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN-PGVYEDIAFFHNWIK 250

  Fly   252 RVVEQH 257
            ..|:::
  Fly   251 YTVKKN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/223 (33%)
Tryp_SPc 34..253 CDD:238113 74/226 (33%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 74/224 (33%)
Tryp_SPc 29..250 CDD:238113 74/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.