DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG31267

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:98/233 - (42%) Gaps:28/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RIIGGHVSSIKEEKYLVQVTTS--EELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASNQAGP 95
            ||:||..|.:....|||.:..:  ...|.||::..:||||||.|:....||:.::.....|..|.
  Fly    44 RIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGS 108

  Fly    96 YAVIRTVDYIAIRPDFNRKTLNMDVAALRLNS----DMIGANIETIPL------AAQSVPARALV 150
            ...|.:|:.|.:..:|:....:.|:|.::.::    |.:..||...||      ...::......
  Fly   109 EGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGST 173

  Fly   151 KVSG---WGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDS 212
            ::.|   |.....|.|..|..            .|.:.:.|...:....:||.......:|.||:
  Fly   174 EIGGDFSWQLQQLDVTYVAPE------------KCNATYGGTPDLDVGHLCAVGKVGAGACHGDT 226

  Fly   213 GGPLV-YRGQLAGIVSFGYGCASALPGIYTSVPEIRDW 249
            |||:| .||:|.|:.::|..|....|.::..:.....|
  Fly   227 GGPIVDSRGRLVGVGNWGVPCGYGFPDVFARISFYYSW 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 56/231 (24%)
Tryp_SPc 34..253 CDD:238113 56/232 (24%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 57/233 (24%)
Tryp_SPc 45..268 CDD:238113 56/232 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.