DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG32755

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:253 Identity:81/253 - (32%)
Similarity:120/253 - (47%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IQPRIIGGHVSSIKEEKYLVQVTTSE---------ELCGGSLVKPRWVITAAHC---------VY 76
            |.|:|:||:..:|.:..:.|.|....         .:|||:::..|.|.:||||         ||
  Fly    34 ILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVY 98

  Fly    77 NKNKNDFKIYGGASNQAGPYAVIRT--------VDYIAIRPDFNRKTLNMDVAALRLNS--DMIG 131
                .|.::|...   ||..|:.||        |..|....|:|..||..|:|.|.||.  ....
  Fly    99 ----RDPELYVVV---AGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWES 156

  Fly   132 ANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSM 196
            ..:..||||.::........:.|||.:|. ..|:|. :....||:.::..|    :.|:::..|.
  Fly   157 PGVRAIPLAIKAPEEGTTCLIHGWGKVTM-KEKSAS-LQQAPVPILNKELC----QVIYKLPASQ 215

  Fly   197 VCAARLYKK-DSCDGDSGGPLVYRGQLAGIVSFGYGCAS-ALPGIYTSVPEIRDWFQR 252
            :||..|... |:|.|||||||:..|:||||:|:|.|||. ..||:||:|.....|.:|
  Fly   216 MCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 77/245 (31%)
Tryp_SPc 34..253 CDD:238113 79/249 (32%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/246 (31%)
Tryp_SPc 38..273 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455670
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.