DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG32523

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:231 Identity:77/231 - (33%)
Similarity:113/231 - (48%) Gaps:19/231 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IQPRIIGGHVSSIKEEKYLVQVT---TSEELCGGSLVKPRWVITAAHCVYNKNKNDFKIYGGASN 91
            |:|||:||  ...|:.::..|::   ..|..|||.::....||||.|||  |:.||.......|.
  Fly    33 IEPRIVGG--IKAKQGQFPHQISLRLRGEHYCGGVIISATHVITAGHCV--KHGNDVVPADLWSI 93

  Fly    92 QAGPYAV----IR-TVDYIAIRPDFNRKTLNMDVAALRLNSDM-IGANIETIPLAAQSVPARALV 150
            |||...:    :| .|..:.:.|::.....| |:|.|||.|.: ..|||..|.||.:..|....|
  Fly    94 QAGSLLLSSDGVRIPVAEVIMHPNYATGGHN-DLAVLRLQSPLTFDANIAAIQLATEDPPNCVAV 157

  Fly   151 KVSGWGFLTADATKTAERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGP 215
            .:||||.: |:....::.:..|.|...||.:|...|  ..|:..:|:|........:|.||||||
  Fly   158 DISGWGNI-AEKGPLSDSLLFVQVTSISRGACRWMF--YSRLPETMICLLHSKNSGACYGDSGGP 219

  Fly   216 LVYRGQLAGIVS--FGYGCASALPGIYTSVPEIRDW 249
            ..|.|::.|:.|  .|.||..|.|..|..:.::|.|
  Fly   220 ATYGGKVVGLASLLLGGGCGRAAPDGYLRISKVRAW 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 74/226 (33%)
Tryp_SPc 34..253 CDD:238113 74/227 (33%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 75/228 (33%)
Tryp_SPc 37..219 CDD:238113 60/189 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.