DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and CG6041

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:272 Identity:82/272 - (30%)
Similarity:129/272 - (47%) Gaps:69/272 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QIQPRIIGGHVSSIKEEKYLVQVTT---------SEELCGGSLVKPRWVITAAHCVYNKNKNDFK 84
            :|:|:|:||:.:||::..|.|.:..         |..||||.::..|.|.|||||.|..:|..::
  Fly    30 KIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVISQRLVATAAHCCYITDKKKYR 94

  Fly    85 IYGGASNQAGPYAVI-----------RTVDY----IAIRPDFNRKTLNMDVA------------- 121
                   .||.:.::           ||:.|    :....::|...|..|:|             
  Fly    95 -------TAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIALMFINGYIPWNWP 152

  Fly   122 ---ALRLNSDMIGANIETIPLAAQSVPARALVKVSGWGFLTADATKTAERVHSVLVPMWSRASCV 183
               ||.|||.::..|.:.:              :||||.|..:.|.::..:.:..||:.|..:|.
  Fly   153 TVTALALNSQLVATNTDCL--------------ISGWGLLQQNGTFSSNTLQAATVPIVSYTTCR 203

  Fly   184 SAFRGIHRITRSMVCAARLY-KKDSCDGDSGGPLVYRGQLAGIVSFGYGCAS-ALPGIYTSVPEI 246
            .::   :.|..|.|||..|. ..|:|.||||||:...|.||||||:|.|||: ..||:||:|...
  Fly   204 ISY---NSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYTNVSYY 265

  Fly   247 RDWFQRVVEQHS 258
            .||   :|:::|
  Fly   266 YDW---IVQKNS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 76/257 (30%)
Tryp_SPc 34..253 CDD:238113 78/260 (30%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 78/261 (30%)
Tryp_SPc 35..272 CDD:238113 79/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.