DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and Klk10

DIOPT Version :9

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:221 Identity:63/221 - (28%)
Similarity:96/221 - (43%) Gaps:40/221 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 CGGSLVKPRWVITAAHCVYNK----NKNDFKIYGGASNQ----------------AGPYAVIRTV 102
            |.|.||...||:|||||..||    ...|..:....|.|                :||...:|:.
  Rat    72 CAGVLVDQNWVLTAAHCWRNKPLRARVGDDHLLLFQSEQLRSTNSPVFHPKYQPCSGPVLPLRSD 136

  Fly   103 DYIAIRPDFNRKTLNMDVAALRLNSDMI-GANIETIPLAAQSVPARALVKVSGWGFLTADATKTA 166
            ::              |:..|:|:|.:: .:.:..:.|..|....|...:|||||.......|..
  Rat   137 EH--------------DLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANRRVKYN 187

  Fly   167 ERVHSVLVPMWSRASCVSAFRGIHRITRSMVCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFG-Y 230
            ..:....|.:.|:..|.:.:.|:  ||.:|:||.....:|||..|||||||....|.||:|:. |
  Rat   188 RSLSCSRVTLLSQKQCETFYPGV--ITNNMICAGMDRDQDSCQSDSGGPLVCDNTLHGILSWSIY 250

  Fly   231 GCASA--LPGIYTSVPEIRDWFQRVV 254
            .|.:|  .|.:|..:....:|.:||:
  Rat   251 PCGAATQYPAVYAKICNYTNWIRRVI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 60/214 (28%)
Tryp_SPc 34..253 CDD:238113 61/218 (28%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 60/215 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.