DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33160 and KLK9

DIOPT Version :10

Sequence 1:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_036447.1 Gene:KLK9 / 284366 HGNCID:6370 Length:250 Species:Homo sapiens


Alignment Length:33 Identity:9/33 - (27%)
Similarity:15/33 - (45%) Gaps:8/33 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 PKHKPGVFTSVCYLFE-KYNMEVLFANVSSNVF 265
            |:|       ||.:.: |..:..||....::||
Human    78 PEH-------VCQVVQNKEQLHQLFKQGGTSVF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 4/14 (29%)
KLK9NP_036447.1 Tryp_SPc 24..247 CDD:238113 9/33 (27%)

Return to query results.
Submit another query.